SykkelValdres

Grazing Animals and Wildlife Along the Cycling Routes in Valdres

Sheep, cattle, goats and elk — how to safely encounter animals along the cycling routes in Valdres. Practical tips for mountain farm roads and mountain tracks.

grazing-animalsmountain-farm-culturewildlifesafetyvaldressheepcattleelkmountain-farm-roadscycling

Grazing Animals and Wildlife Along the Cycling Routes in Valdres

Cycling the mountain farm roads in Valdres between June and September, you are guaranteed to encounter grazing animals. Sheep, goats and cattle belong on these mountain tracks — you are the guest. Here is everything you need to know to cycle safely and respectfully through Valdres' living cultural landscape.

How do I safely pass grazing animals on my bike?

Reduce your speed, ring your bell or announce yourself with a calm voice. Stop if necessary and let the animals move away. Never use startling movements or loud sounds. A cow with a calf can be protective — keep extra distance.

What Animals Will You Encounter — and Where?

Valdres is one of Norway's most active mountain farming regions. From mid-June to mid-September, thousands of animals graze in the mountains. Here is what to expect along different routes:

Rules and Advice for Grazing Animals

Sheep and Lambs — the Most Common Challenge

Sheep are everywhere on the mountain farm roads from June to September. They react differently: some bolt away, others stand in the middle of the road and stare. Lambs can suddenly run straight in front of your bike.

What to do:

  • Reduce your speed to walking pace when you see sheep
  • Ring your bell or say "hello" in a calm voice — do not shout
  • Let the animals move at their own pace. Stop if necessary
  • Cycling in a group: pass one by one, not as a pack

Cattle — Keep Distance from Cows with Calves

Grazing cows are usually calm, but a cow with a calf can become protective if you get too close. Bulls in pasture are uncommon, but it does happen.

What to do:

  • Keep at least 15–20 metres distance from a cow with a calf
  • Never cycle between a cow and her calf
  • Is the road blocked by cattle: stop, wait, or find an alternative passage
  • Bull with a nose ring? Give extra space

Elk — the Big Surprise

Elk are most common in the forest areas of Etnedal, Sør-Aurdal and along Begna. They are most active at dusk and dawn. An elk on the road is impressive — and potentially dangerous.

What to do:

  • Stop immediately. Never cycle towards an elk
  • Do not stare directly — elk can perceive this as threatening
  • Wait until the animal retreats. Most elk will avoid you
  • A cow elk with a calf is most unpredictable — back away calmly

Grazing Season

Valdres' grazing season follows a fixed rhythm. When you plan your trip, you know what you will encounter:

Routes with the Most Wildlife

Some routes offer almost guaranteed animal encounters during the grazing season:

Mjølkevegen — 250 km through mountain farm landscapes. Sheep along the entire route, cattle at active farms around Golsfjellet and Vaset. Grazing animals are part of the experience.

Stølsvidda routes — Stølsvidda has some of Valdres' most active mountain farms. Goats, cattle and sheep along gravel roads with wide open views. Here you see living mountain farm culture from the saddle.

Panoramavegen — Sheep grazing in the high mountains with Jotunheimen as a backdrop. Classic Norwegian mountain landscape with grazing animals in the foreground.

Etnedal forest roads — Best chance of seeing elk in Valdres. Quiet forest roads where elk cross early and late in the day.

Vaset mountain farm roads — Short gravel routes through active mountain farm areas. Perfect for a relaxed ride with wildlife encounters.

Bike Bells and Animal Safety

A bell on your handlebars is the simplest measure for safe coexistence. It gives animals advance warning so they can move before you are on top of them. Especially useful:

  • On winding mountain farm roads with blind corners
  • In forested sections where elk may be standing roadside
  • In fog or poor visibility in the mountains

Bike bells are available at lokal operatør in Beitostølen and Fagernes, or at BUA Valdres (free loan of outdoor equipment).

Dogs on Cycling Trips

If you have a dog with you, the grazing season is especially important to plan for:

  • Leash rules apply in open country from 1 April – 20 August throughout Valdres
  • Many municipalities extend the leash requirement to 15 September due to grazing animals
  • Dogs and grazing animals are a poor combination — keep your dog on a short leash
  • Read more in our guide: Cycling with a dog in Valdres

Mountain Farm Experiences from the Saddle

The animal encounters along the road are not just something to manage — they are part of what makes Valdres special. Active mountain farms with milking, cheese-making and freshly baked flatbread can be found along several of the cycling routes. See Mountain Farm Culture and Cycling in Valdres for an overview of farms you can visit.

Some of Norway's last active traditional dairies are found along Mjølkevegen and at Stølsvidda. Cycling past a mountain farm where the goats have just been milked and the sour cream is freshly churned — that is Valdres at its finest.

Photographing Wildlife from the Saddle

Wildlife encounters in Valdres are among the highlights of any trip — and deserve great photos. But reaching for your camera while cycling requires a little technique:

Best photo routes for wildlife:

  • Stølsvidda — cattle and goats in open landscape with mountain backdrop, perfect natural light all day
  • Etnedal forest roads — elk in twilight by forest tarns, black grouse along trail sections
  • Mjølkevegen — sheep against the Jotunheimen silhouette, classic Norwegian mountain motif
  • Panoramavegen — ptarmigan and rough-legged buzzard over the plateau, highland landscape with grazing animals

Insects and Small Creatures — the Underrated Part of the Trip

The wildlife along the cycling routes is not just about the large animals. Valdres' mountain nature has a rich insect life that affects your ride more than you might think:

Practical tips:

  • Above 900 m asl there are noticeably fewer insects — a bonus with high mountain routes like Valdresflya and Stølsvidda
  • Dark clothing attracts horseflies. Light, close-fitting clothing keeps most insects away
  • Tick checks after rides are important in the lowlands — Valdres is in the zone for tick-borne disease (Lyme disease)
  • Mosquito repellent with DEET or Citriodiol works best. Always carry a small bottle in your saddle bag

Gates and Fences — the Rules You MUST Follow

Along the mountain farm roads in Valdres you will encounter gates — simple openings in the fences that keep grazing animals within defined areas. The gates are part of the grazing system and absolutely essential for farmers. Here are the rules:

Where will you encounter the most gates?

  • Stølsvidda — most active gates, especially between the mountain farm areas
  • Vaset mountain farm roads — 2–4 gates on a typical gravel loop
  • Etnedal mountain farm roads — gates at the transition between forest and pasture
  • Mjølkevegen — fewer gates, but some sections have fences along the road

Important: An open gate does not mean it should stay open. Grazing animals may have moved away — but they will return. Always close it.

Wildlife Outside the Grazing Season — What Can You See from October to May?

The grazing animals are indoors from mid-September, but wildlife in Valdres does not stop there. Cycling in the shoulder seasons — April–May or September–October — you encounter a different landscape:

Spring bonus: Early season (April–May) offers a quiet landscape without grazing animals, but with bird life in full swing. Cycling along the Begna river in May, you may encounter roe deer in the morning mist and golden plover singing from the bogs — without having to navigate around flocks of sheep on the road.

Autumn bonus: September–October gives empty mountain farm roads, autumn colours in the birch forest and a chance to see elk along the forest roads in Etnedal without summer traffic. Note that hunting season starts in September — wear visible clothing (yellow/orange) if you cycle forest roads.

Summary

Grazing animals belong in Valdres' mountain world. They make the cycling experience richer, but require that you show consideration. Slow down, keep your distance, and enjoy the encounters. Most cyclists remember the elk by the roadside or the lambs running alongside their bike just as vividly as the route itself.

Enjoy your ride — and share the road with those who were here first.

See Also

← Back to guides